FASTA Format

A FASTA-formatted sequence has a one line header followed by one or more lines of sequence data. The header line starts with a ">" character immediately followed by the sequence name. The rest of the header line may contain a more detailed description of the sequence. For example:

>AtLRP1 Lateral Root Primordium 1; contains Pfam profile PF05142
MGMVGLRDVFLVAPAYHHQNAGVISGSDHMNSNAAAAAALGVGVIPLLTAGTPQQNVEDSDINFLGNNR
RWQNNNNNHETQYLHFKSTNQTTVGTSSNNSGSGSGASGTATCQDCGNQAKKECKQRRCRTCCKSRGFD
CSTHVKSTWVSAARRRERQVMPTGANPTAGSSLSTSSGTKKPRIVGSQQQQQQQATSHTSTSNTPPQSF
ETSSSRQDGGGSREAWPGQVRAAAVFKCVRVTAVEDGDDEYAYQAVVKIGGHVFKGFLYDQGLEPKEGF
PSMSDLHLGGSANNHNGVSASAPILDPPNVVYGGGGGSGGGFYS